DPCstruct | MC12771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 185 ± 26 aa |
| Standard deviation of domain lengths | 26.19 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0JFF9 | 5-199 | EWRLFGVEVPVLESGPDNLLNVSSALHRAVAQQLSLEPERLPINNVHLVRQSLDARPRGGRRGRSGSGDSDRDVCWSHVVDVTLTPE… |
| S6GEW1 | 2-166 | IRLTNLKLALDHNEDALKNIIMSTLKIRGEQLLDFSVFRRGIDARKKSNILLLYTIDVKTTDEEALLSKFSDNQSIRLTPDMAYKFV… |
| E1ZR27 | 387-583 | None |
| A0A178UV79 | 71-276 | None |
| J4W260 | 1-178 | None |
| A0A1I6IMC1 | 2-161 | None |
| A0A444XAL8 | 68-281 | None |
| A0A7S4E7Q7 | 6-192 | None |
| R7QYC1 | 13-171 | None |
| A0A482RVR6 | 7-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.