DPCstruct | MC12770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 126 ± 14 aa |
| Standard deviation of domain lengths | 14.19 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0540 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0X7K0 | 316-455 | HKLLYFLRPVFHTMEVLAETVTAIRQTNCRGGTVLTLLHDKITSTTGDEKSQKVLIHLIEQAAVPYMEMLQLWIREGVISDPRREFL… |
| A0A0M0JEK4 | 1-120 | MAQLARTCAPLKGGAMIVAIARHERHGDPLVRGYVRHLLRAAAAPLFGMIRMWVLQGELRDAHEEFFIESRATPLTALWEQRYALIA… |
| A0A7T8KCV4 | 113-252 | None |
| A0A7D8YUS8 | 620-736 | None |
| R7U9F3 | 57-194 | None |
| A0A7S1XXV6 | 277-373 | None |
| D8LBZ5 | 766-895 | None |
| A0A7S1JV83 | 13-149 | None |
| A0A2G5BJ12 | 365-477 | None |
| A0A448XJB5 | 90-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.