DPCstruct | MC1277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 127 ± 14 aa |
| Standard deviation of domain lengths | 14.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C4F5X1 | 19-151 | RSTGCLRHIREVCTRRFPVVGQTLCQRPAQVKCGVLETPEWRITPNHEGERVNSQRWMDGDFGGPLGIIENELRPRVYPSYLRNDWA… |
| A0A656KTX5 | 78-209 | TPPRIPQLRTLQDVVGSKDPVFLDWLVGLAFPCQRPFGHQNGVDETPKWRILPDRFGAEANSPVMDNNGGGPLGVTELLAKATTMAT… |
| X7Y9N3 | 408-534 | None |
| A0A399TKF5 | 149-266 | None |
| A0A6G3V3U1 | 94-188 | None |
| L7KNX2 | 109-242 | None |
| A0A0M4PUW5 | 201-330 | None |
| R4MC12 | 1-149 | None |
| A0A498R2F7 | 81-220 | None |
| A0A846YEV8 | 2-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.