DPCstruct | MC12769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 267 ± 36 aa |
| Standard deviation of domain lengths | 35.73 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0JE59 | 1-262 | MSTETYGVMLSTLLNTNENLEAQISANYAMVDYAFLQRLEELIGQGNEENIERLRDIKTAVNSEMAKRMTAAAQAMKDLVTSPTPIV… |
| A0A836B2I3 | 8-245 | IDKLLSAKTQQQLAQLVAENVVAVDTKFWMRIATRNDTAASKEDKDKLQGLATSVMVLVDTVRRRTEQQLEDSGQVLQDILVAAADD… |
| A0A7I4F0W2 | 134-398 | None |
| K0TLD5 | 176-462 | None |
| A0A2U1QD28 | 348-676 | None |
| A0A7R9UVW9 | 30-322 | None |
| A0A6U3Q4G0 | 68-376 | None |
| A0A497ABT9 | 227-439 | None |
| A0A7R9WBE0 | 83-352 | None |
| A0A7R9UQZ6 | 29-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.