DPCstruct | MC12768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 270 ± 42 aa |
| Standard deviation of domain lengths | 41.70 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4C065 | 179-420 | STPAYNGPSPGEGKLEGLEVSLPLPEVGLVLEVAQSVVSGAAGRGLFIRLLDGFERVTLQEGTAVCGYAAGSMHTDADSMGGKTVAF… |
| A0A0M0JD63 | 40-317 | QWADEISAEQAEDLTEEEQALMAMSDDELIALADAADTVELEEPAPPPYQGPTPAPGETLRGVVCSIELPEVGLILEVAESLASGGD… |
| A0A812RTW4 | 67-336 | None |
| W7TZP2 | 79-305 | None |
| A0A7S2PR81 | 61-322 | None |
| A0A812N9V6 | 321-578 | None |
| A0A812ZYD6 | 442-713 | None |
| A0A812TAU8 | 200-552 | None |
| A0A812ZPN5 | 79-377 | None |
| A0A7S4DXZ2 | 6-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.