DPCstruct | MC12767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 319 ± 24 aa |
| Standard deviation of domain lengths | 23.82 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6T8YVZ8 | 134-435 | EADATRALADAFVREIGAGSDRHGTLEGVLSALEAELLMPLRAFNERVSDLLQPGSRVDRSLLPADKVSEVVSTITAHVLDGSFKQW… |
| A0A0M0JCZ8 | 1-337 | MQALVTALATLPAAEPRQQAEVLLIRAFCEEIGDPTLAANATFEGVAAALHAELLLPMRAFHEGIRSMHTTFNGTPIPPKLINAAVR… |
| A0A813KIT3 | 163-498 | None |
| A0A830HX06 | 102-394 | None |
| A0A1Q9CHE3 | 314-666 | None |
| A0A7X3MML1 | 326-635 | None |
| A0A812IB69 | 130-439 | None |
| A0A7S3SCT0 | 162-474 | None |
| A0A6G3M404 | 101-381 | None |
| A0A813C2P5 | 487-841 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.