DPCstruct | MC12764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 205 ± 19 aa |
| Standard deviation of domain lengths | 19.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17830 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0J995 | 17-195 | EVQAKMEADRAEAAKMAANGPNGWMTPELMTKIAMSPILRKGFTDPRCQTAMGEMQANPAAAMKKYGDVPEMKEFLQAFAKVMADHF… |
| A0A3R7MDV4 | 87-267 | QSASSTETKEHVEDIPHIKATPAKSSLVLSEVQEAMKETREAKDFQESISKRLESNPKVSDVLSDPAWIPILDEFQRDPEAAMKKYK… |
| A0A812BQK8 | 146-382 | None |
| A0A1I8IZG1 | 742-942 | None |
| R7V7L8 | 93-313 | None |
| A0A0R3W251 | 1-203 | None |
| A0A1X7VKL2 | 118-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.