DPCstruct | MC12762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 175 ± 28 aa |
| Standard deviation of domain lengths | 27.64 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4FA25 | 1-150 | HVDLPSELLGKFAEYYSEEGLRKRLELMKHPAIVMALERLWEAANTDAADEMIDFKEYTEMHRKITLALMPEQGPRQALKSADEDWV… |
| A0A0M0J8E6 | 7-208 | FDIKASTRTAAVEAEQLLDAGGVVTSVDDAADLEKTEYWQQGDASLATKEKMEARQALRYNKHVLAALQLYWEAAQRSLHSGGDPSA… |
| A0A1W0A3U0 | 340-485 | None |
| A0A7S1KR26 | 196-322 | None |
| A0A7S1NQ02 | 95-277 | None |
| A0A7S1NN57 | 115-232 | None |
| A0A7S1NER1 | 31-165 | None |
| A0A7S4EY68 | 103-319 | None |
| D0NMD2 | 47-245 | None |
| A0A7S1F5M3 | 53-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.