DPCstruct | MC12761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 239 ± 40 aa |
| Standard deviation of domain lengths | 39.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0UX99 | 94-338 | LRPWQPGEQTKKLFTSFEYIPSRFSLADEIASNERVTSEAIRLTIGKGREFFPASNKKVSKFNDYDIERDGNFPYLGSAFENVDELK… |
| A0A0M0J6G7 | 1-300 | MWLQQDAGNSVVLVSPRKKVSPRALPIRGARIPNKNGPLSGRGFTTFAYSIEGQSDPYELSERARRPGSCRDSKPTGMEPLSPRPVF… |
| A0A7S0DVD8 | 5-239 | None |
| A0A1R2D1V8 | 109-304 | None |
| A0A812QDH3 | 2-328 | None |
| A0BDB5 | 74-280 | None |
| A0A7R9Z731 | 1-241 | None |
| A0A7S3N2M8 | 1-212 | None |
| A0A7S2W7G7 | 228-433 | None |
| A0A7S1C302 | 93-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.