DPCstruct | MC12760
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 273 ± 31 aa |
| Standard deviation of domain lengths | 30.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0K2D5 | 41-329 | STTVWSTSAIPECNGGEPDAIFDADTHTLMNARNPELQEKIMAQAALEFKQLKIDRMSLIGETSPLYAGLRYNLAEYYVRVRDLVCA… |
| A0A0M0J2M5 | 12-257 | ITPSKRGDENLDSRSLYKDLKYNMGDYFARVRDLVCAAVPDNLCPTLDCAITLKLFPQFVDGITIGQRTKDDVPDECDRAQNEKAMK… |
| A0A0M0LT05 | 80-360 | None |
| A0A0M0KE52 | 56-330 | None |
| A0A0M0K9D5 | 4-349 | None |
| A0A0M0K6M6 | 65-376 | None |
| A0A0M0K671 | 921-1178 | None |
| A0A0M0K3H0 | 226-507 | None |
| A0A0M0JXR7 | 1-215 | None |
| A0A0M0JIL1 | 97-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.