DPCstruct | MC1276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 9.14 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A9EMP4 | 34-103 | PTPAERVIAKLGGTKVVATVVQRARQNVERWKKPRAEGGTGGLVPAPHQVELLRHALVTGADLELEDFFP |
| A0A1I3TCR0 | 1-71 | MPTPAEKIIAKFDGARSLAHAIGVKPSAVYRWTYPRERGGTGGYVPTAHIPKIKDAADLLGVVLTAEDWEA |
| A4YU09 | 2-78 | None |
| A0A437NY75 | 36-111 | None |
| A0A7L9WLI1 | 1-81 | None |
| A0A6F8USI6 | 21-92 | None |
| A0A1B9SFN2 | 1-71 | None |
| A0A3A4K460 | 6-88 | None |
| A0A2V3R0L8 | 109-182 | None |
| A0A839U1Q6 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.