DPCstruct | MC12759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Standard deviation of domain lengths | 13.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C6TAQ8 | 2-102 | KLKFTKAWIAYLRLPLPIDVYKEVLVNLHQAVIPHLSNPIMLCDFLTRSYDVGGVVSVMALSSLFVLMTQYGLEYPNFYEKLYALLV… |
| A0A3B3X2M8 | 187-283 | HDHKRAFEKMWLGFLKYKLPNSMYKKILVVLHDSILPHMSKPTLMIDFLTAAYDVGGAISLLALNGLFVLIHQHNLDYPDFYKKLYN… |
| A0A444TPB8 | 7-96 | None |
| A0A238C3E6 | 129-241 | None |
| A0A6J1P6Q5 | 18-134 | None |
| D3PJK6 | 125-217 | None |
| A0A4S9LXZ2 | 574-674 | None |
| A0A1D6Q599 | 34-148 | None |
| A0A0H5RRZ4 | 128-229 | None |
| A0A811P5A9 | 388-517 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.