DPCstruct | MC12757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 116 ± 16 aa |
| Standard deviation of domain lengths | 15.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7LN94 | 156-282 | RRRNEQLERFRREEEEKNRKIREAYGRAMDLLKSCLNNEQRDSLEKSKFFYVTAPSGRKYRIDEGTHGNLKVVNKEGRVIERLCVQP… |
| A0A7T8BRF8 | 5-118 | RELYRSSQRERTPEARGRKLLREWLSPGQRETFDSHGYVDVLGSESGQRYRIYYGSISNIRELNEKDDPVAGLCFGPAAALPPGDVM… |
| A0A4Q7FU34 | 16-128 | None |
| A0A522N2R1 | 26-140 | None |
| A0A831T0T2 | 26-145 | None |
| A0A353H5Q4 | 86-214 | None |
| A0A523AWP9 | 101-191 | None |
| A0A523AZH7 | 137-243 | None |
| A0A7T7YHF0 | 2-93 | None |
| A0A3A4UXE5 | 6-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.