DPCstruct | MC12752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A348ZZG6 | 12-120 | IPAHLRFAEIPAHLTSPEIVEKRGSNIFPCHGSADPYIDDRWVKATPTHDLASCKKSGLPPIHFNGEDDALTPHRALDGRLNVEYVR… |
| A0A840HB12 | 2-111 | KNHLTTEKLRTSMGTDIFTWHGFTEVHVDGAWRKATPTFNDTLCAKVGVAPLDFDGHTDALLHPFDGEGRAYMQYVNDRGTYHDVPA… |
| A0A3N5FFD8 | 229-350 | None |
| A0A3D5DQQ6 | 59-152 | None |
| A0A7I8MWR1 | 11-121 | None |
| A0A1Q8JF93 | 20-136 | None |
| A0A128ESS1 | 478-585 | None |
| A0A7C2SRU3 | 118-233 | None |
| W7WKN4 | 5-111 | None |
| A0A1V4RVN0 | 84-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.