DPCstruct | MC12751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 105 |
|---|---|
| Mean domain length (aa) | 284 ± 47 aa |
| Standard deviation of domain lengths | 46.64 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 16.76 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | PF03706- CL0403 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7CNU4 | 156-458 | IEAYITTVDGTTFILFALIAMGIKFVGVLSSAFAWHLLLKGQGIVFPFWQTIVTSFLIGRFIGTFLPSTIGLDGYTLYEAGKYSNQW… |
| A0A840H7Q7 | 2-267 | LLFAQTFVLCHRWILILRAMSVPLGWLAGWRILIISTFFNQVLPAGGDAVRIWMLRRNGVQWSQTIGSIVADRFLALLALGLIVLAG… |
| A0A2M8FD47 | 12-316 | None |
| A0A182TUM2 | 537-836 | None |
| A0A257SP48 | 2-224 | None |
| A0A6J7S4D8 | 4-298 | None |
| A0A832AYZ5 | 20-349 | None |
| A0A350J050 | 2-204 | None |
| A0A6C1RL97 | 6-290 | None |
| A0A2M6YD10 | 18-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.