DPCstruct | MC12750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 207 ± 43 aa |
| Standard deviation of domain lengths | 42.93 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V6TDM3 | 2-199 | YIALWNELQQIEYARTMRQQEELQAQQDQLAKENAQIIDFRSNVNQVDYVINEKWSSLSGSKQYDKAGDAAELVNDEITEIVGSVLP… |
| A0A6G1KA51 | 43-301 | QPPQQRYVTHNDLWTTIRNLDEAFVRETLFHAAVGNLSQPQILNKVVDVHEARSREEAGRMDAQRTDEDLRLREENVRVDALRRVEE… |
| A0A4S9Y965 | 43-278 | None |
| A0A423WYP8 | 36-254 | None |
| A0A395HVF9 | 46-238 | None |
| A0A6A5KFL6 | 6-154 | None |
| J3NNQ8 | 180-368 | None |
| A0A6A5YNZ3 | 37-217 | None |
| B2B527 | 145-431 | None |
| A0A1Y2EBT0 | 140-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.