DPCstruct | MC1275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A176F0C1 | 10-107 | TVISEVHRAQAHALSIRARAEMRLAEEYDAAQERGEVRANGERTFSKEEKVGASDLGLSGKDIHEARHMRDAEAADPGVIERTVNDM… |
| A0A1I3LLV5 | 1-86 | MEIEAQAKRRLADEYDAAQERGEVAANGQRGKAVPDGNSLATVADLGLTRKAIHEARQLRDAEAADPGVIRRTLDARLAEGREPTK |
| A0A1H8PNN1 | 3-95 | None |
| A0A7W6LKP7 | 61-163 | None |
| A0A2W6T7V5 | 115-202 | None |
| A0A4R2CZY1 | 8-100 | None |
| A0A839X2S5 | 67-153 | None |
| A0A182D7J7 | 46-139 | None |
| A0A258IEQ4 | 2-69 | None |
| A0A4Q0QBJ3 | 56-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.