DPCstruct | MC12747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 65 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01355 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536YWR2 | 2-69 | VSESEPTAVALKYKMDATKATDRKDAKALCSNCNFYTGKPGDANGPCSVFGGKLVAAKGWCASWAKKA |
| P00266 | 1-63 | GTNASMRKAFNYQEVSKTAGKNCANCAQFIPGASASAAGACKVIPGDSQIQPTGYCDAYIVKK |
| A0A4R5QJJ2 | 1-45 | None |
| A0A0R3QCK6 | 310-383 | None |
| A0A0F9H3R1 | 40-97 | None |
| M0MHZ2 | 137-194 | None |
| C6XZ75 | 75-144 | None |
| A0A063BE60 | 3-85 | None |
| A0A0F9U604 | 23-82 | None |
| A0A258W433 | 48-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.