DPCstruct | MC12746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 111 ± 7 aa |
| Standard deviation of domain lengths | 7.22 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 37.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P1SP30 | 1-109 | MTIELEPYQVFLVLSAVLSAVAGMIKLMGSQINKNIQQNFESTNQKIEEVSRQAAKGQEEVRELERKFLEFKADMPFRYIARDDYIR… |
| A0A840G4E4 | 1-126 | MTVQVELWGLITFLVMLAITFMGCVFGFARVLGAQIDQRLSEKFKAQEEAREVGSKALREHIDRYIAQADRTADQVATLERDFLRWQ… |
| Q2W6G2 | 1-111 | None |
| A0A077JMX4 | 1-124 | None |
| A0A3R8UK16 | 1-102 | None |
| A0A522P5X6 | 1-101 | None |
| A0A2G3JFL0 | 1-109 | None |
| B7WXU3 | 1-111 | None |
| A0A845BW35 | 1-110 | None |
| A0A1F4AV79 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.