DPCstruct | MC12744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S3TAB7 | 19-74 | PDGLMVRVDRAERESLLDRPGVAEQRMGERVMGGWVRVDAGALAEDAVLREWVGRV |
| A0A838PSI6 | 1-64 | KGGVLVRIDPDESDDLVAAPGVERMVMGGREMENWLYVDPGQVQTKRDLAPWVERGVAFAATLP |
| A0A2H1IFT1 | 5-70 | None |
| A0A3A0D2Z1 | 2-60 | None |
| A0A260TZ80 | 13-70 | None |
| A0A1W6LD62 | 2-60 | None |
| A0A1I0VY88 | 54-123 | None |
| A0A538DXJ4 | 281-343 | None |
| A0A4Q3DQ97 | 109-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.