DPCstruct | MC12742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Standard deviation of domain lengths | 4.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660LAX5 | 9-85 | APTVVIRAARGSDGPALRRLAALDSHELLTGDVLVAEADDQMVAALSVDTGEKVADPFVRTADVVDLLAYRARGLRT |
| A0A838PIT2 | 9-93 | RTPTSVGQAGDVTVRLADYSDAAALVRLADLDDTRVPDGPVLVAEAGDRPVAALPLNGGRAIADPFHRTTALVEMLDLRARQLRD |
| A0A660LAR5 | 10-93 | None |
| A0A538GMR8 | 32-114 | None |
| A0A2W5XY98 | 34-114 | None |
| A0A6J4T5Q2 | 14-104 | None |
| A0A538C5A0 | 38-128 | None |
| A0A660KY30 | 2-78 | None |
| A0A5B8UBW9 | 3-77 | None |
| A0A7W0K0P0 | 3-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.