DPCstruct | MC1274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 128 ± 13 aa |
| Standard deviation of domain lengths | 12.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A841GLX5 | 1-128 | MPYTAEKPPLRRSIEELRATIPGWGVDLDPADRPGIPNQRFAPEITGAHWDFPERQPELWPRERSPEHKFLTPVFGTSCPPKGLSGA… |
| A0A853C4L2 | 1-131 | MTNIPYAGGHRAGIPSADDLRARIPGWGADLDPADRPSHPREVPGAIRSGSAGEVPENQPERWPRERSIEHARLTPVFGSTLPPRGV… |
| H8MQX4 | 28-159 | None |
| A0A1M3MUE8 | 1-123 | None |
| A0A1G5BS00 | 7-127 | None |
| A0A2T4VD54 | 1-119 | None |
| A0A7W9BW30 | 1-157 | None |
| A0A4Q6DCA9 | 30-152 | None |
| A0A6N7PX42 | 1-109 | None |
| A0A074L5M5 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.