DPCstruct | MC12739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 5.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08846 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351L7N2 | 1-63 | MFWWLEVKTKQPNCIYYFGPFDSAIEAEQGQEGYLEDLKQEGAQEIEAQIKLYSPNELTIFQD |
| A0A2E6GHM2 | 2-71 | IRNFGNKLGLAWWAKVETNSPNAVYWYGPFLTKNSLKQNLNDFMRDLSDEGSNNIKHTLIRCKKTEPLTI |
| F5UMW4 | 21-85 | None |
| B4VUI9 | 67-131 | None |
| U7QI54 | 79-139 | None |
| E0UIE2 | 17-91 | None |
| A0A0P7Z3R1 | 32-108 | None |
| A0A838VQ69 | 15-90 | None |
| A0A6P0TI60 | 6-72 | None |
| A0A2T1D905 | 4-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.