DPCstruct | MC12732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 139 ± 18 aa |
| Standard deviation of domain lengths | 17.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06684 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8XIX2 | 27-185 | TRRAACVAVIENPCAGKYVEDLTELMEIGEELGELLTQRAIAALGIPGSTVESYGKAAAVGENGELEHAAAILHPKLGAPVRKVLGK… |
| A0A0R2R1V0 | 3-127 | AEISGQLAERALAALGVEAGEVTAYGKAAIVGTAGEIEHAAALIHPRFGAPIRKVVVQGLDIIPSTKKVAGPGASITIPITNKDDIW… |
| A0A7X1EA00 | 27-163 | None |
| A0A442F7C2 | 62-184 | None |
| A0A249Q3C7 | 65-225 | None |
| A0A833FWJ8 | 2-118 | None |
| A0A6P2HCJ9 | 31-182 | None |
| A0A2A6FSZ3 | 111-257 | None |
| A0A2E5P2B8 | 4-159 | None |
| F3C4X7 | 3-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.