DPCstruct | MC1273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 202 ± 17 aa |
| Standard deviation of domain lengths | 17.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L9YWS3 | 21-236 | VSCPSNSLSSPIDDVGSIDVPKFPWPPPNASAKKDLPNEVFSNAIYFKDVDSIISTALENNGYVDRSYFTVPSEENLGFVIVTQMEQ… |
| A0A327P7S8 | 327-528 | VQMPSKSSQYYFFPNPAPKASAYFIKLAFKPTLSTLGQVDSFLSKSLVDAGYKNQLHYYYDMDGFALTTSLEKFNIDGSPVPSEERF… |
| A0A4R1PGD1 | 5-182 | None |
| A0A7L9PWX7 | 1-161 | None |
| A0A3E0DL20 | 638-840 | None |
| A0A1Y1T5N5 | 88-258 | None |
| G8THL1 | 878-1079 | None |
| A0A1V5HBH1 | 42-275 | None |
| A0A1G3XYQ8 | 157-372 | None |
| A0A0S6VW03 | 137-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.