DPCstruct | MC12728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 106 ± 21 aa |
| Standard deviation of domain lengths | 21.20 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R3A028 | 28-120 | IPPEITKQQSNFVYASEADLLNVALFGLTAKEWRDINPDKKGNISDFAIIEQLVVLSNMESINALLIQQGLPQNDRLTQLNKVAMTQ… |
| A0A6I8M809 | 19-108 | YANEADMLNVVIFNKIAKEWRKENPNLKGNLRDYLSINELLVLANMENYNAIMIEKNISQKNRMIEIRNQARSQLLSLEELNNRSIK… |
| Q1NLU0 | 38-124 | None |
| A0A7X7RLI2 | 4-85 | None |
| A0A397RUH6 | 77-170 | None |
| C2BEM4 | 125-229 | None |
| A0A1M6EJE9 | 42-112 | None |
| A0A519M6E0 | 122-252 | None |
| A0A5J5DX39 | 230-356 | None |
| A0A1G6UUN5 | 69-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.