DPCstruct | MC12723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Standard deviation of domain lengths | 7.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 49.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811VET8 | 11-98 | AAEASDPSATSKTSVEPTVRIKCMSGSMLITIKDAPLNHETGLFSGMIYPKGLSKNSTCLTEYRDHQGPLRYKLPLRSCNTMPQETVS |
| A0A182WWS6 | 4-92 | QVEIAQSSATIFTKEPTVRIQCQSGSMLITIKDAPANLNGQFSGMVYPKGLAKNSTCLTEYHEQEGPLRYKLPLKSCNTMPIETVSG… |
| A0A835GK23 | 23-117 | None |
| A0A7R9IXI1 | 365-467 | None |
| A0A182IND9 | 14-106 | None |
| A0A834UG41 | 68-148 | None |
| Q16UL7 | 76-170 | None |
| A0A1A9VN75 | 195-290 | None |
| A0A1B0AH04 | 127-228 | None |
| A0A182Q663 | 73-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.