DPCstruct | MC12722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 706 ± 84 aa |
| Standard deviation of domain lengths | 84.14 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.46 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0264- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182WTV0 | 1-825 | MASVYPRTLGGFTLLLLALAATITPGGGQALITPLDSPLLATKYRGFREIMFNFIGQTGNNKNKFLINLKKGKVQKQFGPEEPFFCN… |
| A0A2I0MAF8 | 208-1063 | LTTSFLAGQDYNNNSNPGWNECNHVGEHSTLDDNILRWSYQDAWEKLLNSERYNQKDDFTVVLQPSLQETNLLHRLGRGSFITTSKV… |
| A0A0S7FKK1 | 1-734 | None |
| A0A2J8K0N0 | 2-623 | None |
| A0A7J5Y8E7 | 8-678 | None |
| A0A401SK08 | 573-1230 | None |
| A0A6A4TQ47 | 153-811 | None |
| A0A0C9M6U1 | 404-1029 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.