DPCstruct | MC1272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 219 ± 23 aa |
| Standard deviation of domain lengths | 23.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A358ENS5 | 21-230 | EIIKLWQSLPELAKTTPDKAYNKLNTWLPERGLRGLYAKAQFALNLSQLEKVSGHTIYLSGPHKKGQLNLKSRSNFGHYNPKFLQWA… |
| A0A3L9YUE1 | 256-464 | AKDETVPWVIRSTWSSAQEYTSPQNDVKGIRGLVAHAKSLISLEKIRFLSPVPIFKSGPHKEEYNWYSNEFGHYNPEFIEWTSKYLI… |
| A0A3C2AB40 | 22-261 | None |
| A0A1Y2K4P8 | 123-335 | None |
| A0A1G0KXN9 | 116-326 | None |
| A0A6I5P4K2 | 46-305 | None |
| A6GGA8 | 43-293 | None |
| A0A4R9K432 | 5-226 | None |
| A0A3D5BL07 | 8-234 | None |
| A0A2E0R1E3 | 408-622 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.