DPCstruct | MC12719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 68 ± 2 aa |
| Standard deviation of domain lengths | 2.43 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 59.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A509E032 | 23-86 | DQVINDDLITSGSLCVGVDCTNGELFSFDTIRLKENNLRLKFMDTSASSAFPSNDWQITINDSS |
| A0A3D1Y552 | 1-74 | MADEVITQELVVQESVCVGAGCRDGETFGFETLKVKSASPLVLFDDTSSSASFPDNDWQIGVSDDVAGDQASFL |
| A0A7X6ABK0 | 155-221 | None |
| A0A3M2BQN9 | 147-213 | None |
| A0A0Q9CU86 | 92-158 | None |
| A0A1I1U9P1 | 26-93 | None |
| A0A2N2PH44 | 150-217 | None |
| A0A7X5VWI1 | 1-69 | None |
| A0A6C7E6X6 | 47-115 | None |
| A0A2V7WCJ4 | 170-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.