DPCstruct | MC12718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 155 ± 17 aa |
| Standard deviation of domain lengths | 16.91 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J7TP80 | 450-580 | KQLQNQSEPCRSEALSGEYRALVMGKPLANRDDIWRTLLIDGKVSAEITTTPLADAIAGIQLYINRTVAGDEPGADNAVLERQFFKD… |
| A0A0B4CZX6 | 514-658 | VPAYRHAFAELKRDALVAAYMKTKVAGDLDLTETIKDRDALYRHLLLDVDVTSAVPTSPIVEAASSLQLYISRALSGLEPEIGFYDR… |
| A0A1V3XST4 | 324-478 | None |
| A0A3M6BBI1 | 624-764 | None |
| A0A509C3A2 | 1-163 | None |
| A0A0N0WPR3 | 1-166 | None |
| A0A3Q9D6W4 | 1-168 | None |
| A0A4D7JP61 | 731-871 | None |
| A0A3M3G8N2 | 373-513 | None |
| A0A4V3F8P5 | 1-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.