DPCstruct | MC12715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 97 ± 15 aa |
| Standard deviation of domain lengths | 14.80 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.82 |
| Pfam Score | 96.77 |
| Assigned Pfam label(s) | CL0039- CL0235- CL0335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S8FW55 | 1-62 | MKVLVAVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGIATEVIAVS |
| A0A7R9MEL5 | 4-94 | LRILVGCKRVIDYAVKIRVKPDKRGVITEGVKHSLNPFDEIAVEEAVRLKEKKLAAEIVAVSVGPQSCQETLRTALAMGADRAIHVD… |
| A0A2A4AU96 | 1-72 | None |
| A0A3M7M090 | 350-457 | None |
| A0A1D2N652 | 1-99 | None |
| A0A4U0VSW3 | 9-117 | None |
| A0A831U1E9 | 1-90 | None |
| A0A482WEE8 | 455-573 | None |
| A0A8B5WU41 | 1-118 | None |
| A0A139Y3G3 | 7-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.