DPCstruct | MC12714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 149 ± 15 aa |
| Standard deviation of domain lengths | 15.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 45.76 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | PF16420- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9MCS9 | 11-144 | LLSVQTQEVQLLEQLIDDNDVVFLLMDTRESRWLPTVLSAVKNKLVINAALGFDTFLVQRHGVRRTETTGATNDQSIVGAVGGELST… |
| A0A5C2TJK7 | 1-150 | MAHNLSIPMPGHPIPLASVQHVKKNVTALEKLVDEHDDVFLLTDSHESQWLPTMLDTSKGKIVLNTAPGFKTFLVMRHGARTPGADG… |
| W2T929 | 530-685 | None |
| A0A146I083 | 713-852 | None |
| A0A5N4D018 | 119-268 | None |
| A0A2H9TI94 | 305-453 | None |
| A0A0G4LXW2 | 451-589 | None |
| A0A7J7H3D5 | 162-329 | None |
| A0A453BZ73 | 58-214 | None |
| A0A3B0J2E3 | 627-797 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.