DPCstruct | MC12713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 131 ± 14 aa |
| Standard deviation of domain lengths | 14.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13625 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817VLB5 | 1-131 | MSKRSASNDPAGKAAKLLKNIDINVDDDDDDDKVNDEAFSPKAASRPLEDSVDVEDDDLYRASTTGLTNEGLKDFHTEMELKVEHEN… |
| A0A1S4B8N3 | 1-112 | MKEDYRSSAADDDQYYPEEGDDDFQDGEREGKKMDFTKLELKPDHANRPLWACADGRIFLETFSPLYKQAYDFLIAIAEPVCRPESM… |
| A0A3Q0JLK9 | 1-142 | None |
| A0A814NIL5 | 2-146 | None |
| A0A7M4FPZ7 | 1-135 | None |
| A0A1A9WT86 | 2-149 | None |
| A0A0M3K941 | 3-131 | None |
| A0A6G0UPY9 | 1-133 | None |
| A0A397YL59 | 3-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.