DPCstruct | MC12712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 147 ± 9 aa |
| Standard deviation of domain lengths | 8.68 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9MAA7 | 1-158 | MSDPHICDDKDLKELCPSLDLWLKPQAKLNITVALPRLKVLDNSGKTMTISTWEVMDKLKKKIKPLKFKTIKVSKSTIEFIRFEAEC… |
| A0A6A4S1X1 | 7-145 | DTTEAVCLSTEYSLYLKPIAKITVSVALPQLKLPGKSISNWEVMERIKAMVAPEQFSALRISKSTMDFIRFEGEVENKAVVKSLLAR… |
| A0A183T0Y4 | 16-149 | None |
| A0A4Y2L9K1 | 6-147 | None |
| G4V9B3 | 9-155 | None |
| A0A1A9Z8E6 | 17-158 | None |
| A0A7I8VUT7 | 1-149 | None |
| A0A177B2I3 | 21-176 | None |
| A0A131XRH8 | 7-147 | None |
| A0A3P7J3C8 | 1-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.