DPCstruct | MC12710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 717 ± 73 aa |
| Standard deviation of domain lengths | 73.02 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1V643 | 354-1093 | VEEPTEPAVDVEEPTEPVELEPIRDISSLELIKEMRFGWNLGNTLDAECTSWMDYEKNPIGSETCWGNVKTNEDIFKTLMDNQFNVF… |
| A0A7R9LYH0 | 148-801 | ITENDFAEMSKRGLNVVRFPVGWWQIYDPQGGASKAKLNWHVTPTNYITGGLAYIDKAFEWGAKHGIGILLDMHAAPGSQNAFDNSS… |
| A0A1Q2MGZ1 | 32-780 | None |
| A0A4P1R3F7 | 227-811 | None |
| A0A1Y1YSN7 | 3-838 | None |
| A7STC8 | 16-694 | None |
| A0A1Y2ARN2 | 21-734 | None |
| A0A4S4LFG6 | 24-804 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.