DPCstruct | MC1271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 10.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03776 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G6EV76 | 1-81 | MLFGLFRRKKAPSANLAKERLKIIVEHSRSDAKRPEFLNQMRREILEVVNKYVEVDIADINTNIANQGDSEVLELNIILPD |
| A0A7X4Y3M7 | 1-79 | MLDFLFGQNNSKDEAKRRLTLVLAYERKGLPPNFTERLRDELVYIFSKYSQFDVNRIEVDIKKENDDFEELWISIPFKQ |
| Q7MQZ4 | 1-79 | None |
| A0A2E8JQK6 | 1-94 | None |
| A0A2E1K0L8 | 44-133 | None |
| A0A6U2GMJ9 | 12-88 | None |
| A0A2Z2P5H4 | 1-85 | None |
| A0A2E3MGP0 | 1-98 | None |
| A0A5R9J724 | 1-83 | None |
| A0A0E3X1K9 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.