DPCstruct | MC12709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 117 ± 10 aa |
| Standard deviation of domain lengths | 10.25 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9LVT5 | 1-115 | MEALLAIVRARLADALHNDIMLKFTLSALWNLTDESPKTCQMFLQKGGLDLYLQVLQRFEGDCAVETKVLGLVNNIAEVEELRHNLL… |
| A0A6J1SUT4 | 512-627 | MRKLLTMVEARMATKTIDITMKFTLSALWNLTDESPATCHMFLEENGLELFLSMLQVYEFETSIETKVLGLLNNIAEVPGLRSNLMC… |
| A0A553PD88 | 596-723 | None |
| A0A2H1WRV9 | 1-126 | None |
| A0A423SP87 | 278-369 | None |
| T1GPQ1 | 492-617 | None |
| S9XA68 | 335-447 | None |
| A0A3M6UIK9 | 478-598 | None |
| A0A310SIZ1 | 484-599 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.