DPCstruct | MC12708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 236 ± 23 aa |
| Standard deviation of domain lengths | 23.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.44 |
| Pfam Score | 51.67 |
| Assigned Pfam label(s) | CL0020- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8Y615 | 280-483 | PSSLPSEAAAGDLLIGSITYGQGNSNLLGPGKKPDGFPLSMRIPPTKSAKTKPSAAGSSKKKEEKSEAEKLAEAIRDLKVGRLAKLH… |
| A0A7R9LTN4 | 1-276 | MTLQPNTPTPIFIRGMVSYPPDMPLNFSNGAYFTGRIQLADDITRRVDELFAEDYDFNYVVDSQPIVKSGSSVTKVDENESKISPED… |
| A0A7R9PW68 | 705-951 | None |
| A0A2G2X6T0 | 864-1076 | None |
| A0A0R3Q9J1 | 1-237 | None |
| A0A7R9LQZ9 | 242-496 | None |
| A0A3Q1IHC8 | 961-1182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.