DPCstruct | MC12706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 9.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.30 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF05251- PF13888- CL0306- PF04676 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4XCK7 | 258-332 | KAKLEIPYASPVDPESYGFLTVVLLLTGLVFMSLFFTRAVAPKKNAPVELVLAFISALLLGFGSLFLFLWAEIYV |
| A0A7R9LRK9 | 15-103 | IPPTIYPHLSLLSLIIGVFFMPLIPPTIYPHLSLLSLIIGVFFMAWFFTLEVTSKSSSNIVKELTTSLIGSAFIGFGTVFLLLSVGI… |
| E1ZT13 | 8-89 | None |
| A0A0V1LK79 | 23-112 | None |
| A0A3S3PD69 | 4-90 | None |
| A0A498LVI2 | 490-566 | None |
| A0A1I8I3E9 | 84-171 | None |
| A0A671DJQ1 | 210-296 | None |
| A0A6A6LMQ8 | 164-252 | None |
| A0A2A9MNN8 | 46-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.