DPCstruct | MC12705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 242 ± 40 aa |
| Standard deviation of domain lengths | 39.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8F7L6 | 12-215 | IGENHEGAARTQLKIIESQPWIVTAELKSALIKVQTLFKDAAESLFKDSCVRQAVRCVKMAKLVTLQLHLLSHGHSQRVINLRPAEV… |
| A0A7R9LE85 | 8-252 | SEMTYCFDLFKENNEFELLLSKRIEKAPQLRIALLDYLKGDKEVFPLVALRFCLYREIAENHEKRRFVVKLLNFMFNWCLDYSADSC… |
| A0A2P5XMQ4 | 514-800 | None |
| A0A0P0UZE9 | 23-307 | None |
| A0A5B7JS63 | 1-157 | None |
| A0A7J8K172 | 1-172 | None |
| D4HMK9 | 1011-1235 | None |
| A0A6J1WHN9 | 2-229 | None |
| A0A2J7RSB9 | 13-199 | None |
| A0A821V9H4 | 83-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.