DPCstruct | MC12703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 225 ± 50 aa |
| Standard deviation of domain lengths | 49.84 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.28 |
| Pfam Score | 95.32 |
| Assigned Pfam label(s) | CL0023- PF08385- PF18199- CL0016- CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9LDM1 | 790-1030 | KTFSDTSGRPSATGSPIDGYLSSELSQTQRLVQRMDGDINGTDSEFIGDQLAINETPDPWLTQWPNGPKSADTFMRCAAFMASEVKR… |
| A0A0K0DPP3 | 27-277 | WMAQLGELAQQWLKLLPKDIVRMKRTVENIKDPLFRFFEREINLGAELLRDFRHDLEEILGVCRAERKQSNETRALASALQKGVVPT… |
| E7FFM4 | 2412-2682 | None |
| A0A834Y2H2 | 247-519 | None |
| F4PZ52 | 738-972 | None |
| A0A1B0C4S1 | 10-166 | None |
| A0A5J4P0T1 | 503-779 | None |
| A0A820W3E4 | 6-181 | None |
| A0A815GDI2 | 7-197 | None |
| A0A7S3G673 | 675-952 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.