DPCstruct | MC12702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 7.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 36.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1ISA6 | 53-137 | IRFLRSQGWKVRYIRNITDIDDKIIKRANENGETIQQLTTRFIDAMNEDAANLGCLAPDEAPKATEYIDQMQNMIGNLVNKGAAY |
| A0A6V8P1V9 | 52-138 | RRYLLYKGYQVLFVQNITDVEDKIINKARQLGLGWQEVAQKFEREFYQDMEKLGIMPADVQPRATEQIDFMIKMISTLEEKGYAYDG |
| A0A0G0VWE4 | 51-152 | None |
| A0A0G1NX16 | 9-110 | None |
| M1V4Z4 | 56-150 | None |
| A0A452VAS0 | 45-136 | None |
| A0A5J4YNC0 | 73-159 | None |
| A0A554J927 | 54-137 | None |
| A0A0B2Q600 | 22-107 | None |
| A0A4R0XMV7 | 288-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.