DPCstruct | MC12701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Standard deviation of domain lengths | 8.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9TWR3 | 17-109 | AEISTSLSQTAAIAIRILSDVPGMTQASSRDFASARPVFTLKDGTIVRTWKNPVGVDHIFLADAYGRMVFAGYVGWIDSEDLKEAIK… |
| A0A2Z6CKK8 | 1-95 | MESAEELYLSQVKGMIPISEVMGIELKYHSYNISKGDLYLKFPDKSGKIYLFVNAINVHHVYVLDSDDELQFGGYVGWIDQEGLMKK… |
| A0A1U7JBP3 | 92-179 | None |
| I4G7H1 | 152-255 | None |
| A0A551ZJ06 | 19-111 | None |
| A0A1Z4RUX0 | 196-297 | None |
| A0A6M0RFT8 | 4-115 | None |
| A0A7C9Q0G5 | 21-115 | None |
| A0A1Z4FZL9 | 30-144 | None |
| B7JW63 | 19-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.