DPCstruct | MC1270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 118 ± 17 aa |
| Standard deviation of domain lengths | 17.41 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1DCT9 | 179-302 | LHRVLPTDQATAPFPPSTQIHTVSWNVFLRPEQVYSLVMGFCPASTDDKWFVYSQGPDKTGKLKVHFHRSWTGMKIAELFIVVDLKG… |
| A0A3A9BE68 | 5-121 | AIKSDWYTHRMPRNSKTHLRVRIELSEEDFVALAWSHVPTEMEDHWFMYFDGESFNFYRSWTGFCIYKAYMERTENGFVIQKVTVNR… |
| A0A7Y0JV94 | 3-104 | None |
| A0A7W7HHY5 | 3-99 | None |
| A0A6P8BLV7 | 30-135 | None |
| A0A6S5C7I9 | 283-388 | None |
| A0A5S4FXY4 | 31-142 | None |
| A0A517U2P6 | 2-100 | None |
| A0A4U6XU79 | 60-195 | None |
| A0A0B7IPW2 | 17-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.