DPCstruct | MC127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 539 ± 75 aa |
| Standard deviation of domain lengths | 75.33 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A364KVD2 | 52-528 | CRRDRTEDVEAFYNENLIRTHREFTFSVRKAMSAKVELWGEYKGVELFLEIEKSAAVRLVLFVYHPQFFFYHGQTSESALRFRKKFG… |
| A0A6A6E0N4 | 47-566 | ESQIIHHLHQPSMSSARLEDGEVADPSNACVAMVMNNGFVEGHTLIYDHLHRRHQTSEGLEDYPQAVLLAHETFTHRIEDSSEAKVE… |
| A0A4Q4Z017 | 3-526 | None |
| A0A0F9X7Z2 | 84-553 | None |
| A0A0C3H0F3 | 204-691 | None |
| A0A0C3DA08 | 79-712 | None |
| A0A2T2NBC7 | 210-802 | None |
| A0A0S7E3I5 | 89-585 | None |
| A0A2T3ZTL4 | 320-896 | None |
| A0A6A6HFK0 | 19-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.