DPCstruct | MC12698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 194 ± 27 aa |
| Standard deviation of domain lengths | 27.11 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535XHX8 | 745-931 | VAVHTHDEELRAGAIDVSAAGKILIGGSRASAETLTRARAMGVAGIVLGGILDKELRDFTAIQRRRREIGGMTGSFAVVLLEGFGKV… |
| A0A7C7HVS3 | 3-207 | ILVSDRDQELTADLLNEAHQGKIVVGGSFISLETYKKALSLQIAGVVVGGFNYYDLEEILGYTLGVAITGSEDLVTSLVLTEGYGNI… |
| A0A2H5YRJ9 | 170-384 | None |
| A0A7V9VF14 | 27-241 | None |
| A0A3B0V125 | 30-218 | None |
| A0A136LJK7 | 126-297 | None |
| A0A7C6LII1 | 231-481 | None |
| A0A3M0X164 | 1-138 | None |
| A0A660Y6W7 | 57-262 | None |
| A0A535CJL2 | 2-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.