DPCstruct | MC12697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 119 ± 13 aa |
| Standard deviation of domain lengths | 12.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.90 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0261- CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7XX66 | 431-546 | VRQPIELPRTQRRLQQLAAQQLPPGKAAQYNQAMMELGALVCLPRNPRCSACPLRTQCSAQRSQLQALLPVHLPKLRVPHYQVTAGI… |
| A0A7C7G917 | 6-114 | EVVEKGTALFEEKLDKWLNQDRPGDFNQAMMELGSQICRRNEPRCFECSVGSFCKAKAEGNPAVYPNIPKKKERPHKTIVAGIIWND… |
| A0A7V9LEG7 | 62-180 | None |
| A0A3M1R199 | 350-474 | None |
| A0A378MUG5 | 75-191 | None |
| A0A3S4HQF1 | 3-108 | None |
| C0HH95 | 111-249 | None |
| A0A6N2D0X5 | 180-317 | None |
| A0A7T9CBH9 | 167-279 | None |
| A0A5S3RQJ0 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.