DPCstruct | MC12696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 101 ± 16 aa |
| Standard deviation of domain lengths | 16.30 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662TV50 | 269-348 | ATLYAPCDGYIAEVSNFAVSAVAKAAGAPTDKGAGVLLKGKRGYVVEKGDPIMEIYAEYESKLEVAYNLALKLQPVTVEG |
| A0A7C7CVF0 | 4-93 | KAEKDGIIQMMDTTQIGWGLVDMGCGRKQKDDILDSTAGLECHRKVGDKVLIGEKLFTCFCNNEKKLKSGVEKISNAVSIGPEPVEI… |
| A0A2P8ZLA9 | 36-157 | None |
| A0A2H5ZND1 | 72-151 | None |
| A0A7C1X268 | 82-202 | None |
| A0A645HYP4 | 74-195 | None |
| A0A7X6ZU83 | 103-223 | None |
| A0A7C0VDM3 | 128-217 | None |
| A0A832EYJ0 | 1-83 | None |
| F8LWR7 | 163-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.