DPCstruct | MC12691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 255 ± 46 aa |
| Standard deviation of domain lengths | 45.55 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19274 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3C0S2 | 50-278 | MYLLSVYWLETLRVCNSPEPSLQPIIEYLSDTALQKDKSGMWQCVASVGDKVFQKFLDVMSDKVKDESRERELEGHAQFLLVNFNHI… |
| A0A7R9PJ52 | 42-274 | VLDRVQNSSEPSLQPILEYLSDTALQKDKAGMWNCIFSVGDRVFAQFIEVMSNKPKDSNREKELENHAQFLLVNFNHVHKQIRRVAD… |
| A0A7T8KKM5 | 5-230 | None |
| A0A842YV29 | 96-386 | None |
| A0A6S7NCM2 | 2-211 | None |
| A9JRB4 | 836-1073 | None |
| A0A5B7DEB8 | 41-303 | None |
| A0A2W1BGQ8 | 12-291 | None |
| A0A2G9V3P2 | 149-397 | None |
| A0A6A4V1X6 | 205-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.